PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr024864.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 268aa    MW: 29595 Da    PI: 7.943
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr024864.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM591.6e-18257082128
          NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                  yWkatg+dk +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Pbr024864.1  25 YWKATGTDKVITT-EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 70 
                  8**********99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100527.681193IPR003441NAC domain
SuperFamilySSF1019414.18E-271693IPR003441NAC domain
PfamPF023651.6E-81670IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MVLFQSEGPE IPEWVATQSG CWVRYWKATG TDKVITTEGR KVGIKKALVF YVGKAPKGTK  60
TNWIMHEYRL IEPSRKNGSS KLDEWVLCRI YKKSSGSAAA AAAQKPVTSV SSKEHSNGSS  120
SSCSSQLDDV LEWLPDIDDQ NFTLPRINSL KTLLQQQDSK INFQNTSSGN FDWATLAGLN  180
SAPELNLNNQ TEQGQGQMNL NFNNNDVSPF NPASLPRGMA AGEVGKTAEE EVQSGLRTQR  240
VDNSNFFQQH SQNICYPVRP SVFGLWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-41259797169NAC domain-containing protein 19
4dul_A6e-41259797169NAC domain-containing protein 19
1ut7_B6e-41259797169NO APICAL MERISTEM PROTEIN
1ut7_A6e-41259797169NO APICAL MERISTEM PROTEIN
1ut4_B6e-41259797169NO APICAL MERISTEM PROTEIN
1ut4_A6e-41259797169NO APICAL MERISTEM PROTEIN
3swp_D6e-412597100172NAC domain-containing protein 19
3swp_C6e-412597100172NAC domain-containing protein 19
3swp_B6e-412597100172NAC domain-containing protein 19
3swp_A6e-412597100172NAC domain-containing protein 19
3swm_D6e-412597100172NAC domain-containing protein 19
3swm_C6e-412597100172NAC domain-containing protein 19
3swm_B6e-412597100172NAC domain-containing protein 19
3swm_A6e-412597100172NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981170.0KF198117.1 Malus hupehensis NAC domain protein (NAC33) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334627.11e-179PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 72, partial
SwissprotQ93VY33e-65NAC72_ARATH; NAC domain-containing protein 72
TrEMBLS5R6371e-133S5R637_9R
STRINGPOPTR_0011s12400.18e-82(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.29e-62NAC family protein